PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_9151583B9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 201aa    MW: 21717.8 Da    PI: 5.687
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_9151583B9.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.44.3e-5824119297
                  NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 
                            reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv+plk yl+k
  Traes_3AS_9151583B9.1  24 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKHYLHK 111
                            89************************************************************************************** PP

                  NF-YB  90 yrelegek 97 
                            +re+ege+
  Traes_3AS_9151583B9.1 112 FREIEGER 119
                            ******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.7E-5521139IPR009072Histone-fold
SuperFamilySSF471134.79E-4126144IPR009072Histone-fold
PfamPF008085.9E-282993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.3E-205775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.3E-207694No hitNo description
PRINTSPR006156.3E-2095113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MPESDNDSGG PSNTGGEGEL SSPREQDRFL PIANVSRIMK KALPANAKIS KDAKETVQEC  60
VSEFISFITG EASDKCQREK RKTINGDDLL WAMTTLGFED YVDPLKHYLH KFREIEGERA  120
AATSTSTSTT PDMPRNNNNN ATGYADAPGG MMMMGQPMYG SXPPQQQQQH QHQIAMGGRA  180
GFPYLGGGGG SSSSSGFGRK E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B5e-4724114292Transcription factor HapC (Eurofung)
4g91_B5e-4724114292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787380.0KM078738.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-A3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557724.12e-84PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233103e-69NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLW5CLR61e-149W5CLR6_WHEAT; Uncharacterized protein
STRINGMLOC_5897.12e-85(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-69nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]